missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
SNF1LK2/SIK2 Polyclonal antibody specifically detects SNF1LK2/SIK2 in Human samples. It is validated for Immunofluorescence
Specifications
Specifications
| Antigen | SNF1LK2/SIK2 |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | DKFZp434K1115, EC 2.7.11, EC 2.7.11.1, KIAA0781SIK-2, LOH11CR1I, QIKSNF1LK2, Qin-induced kinase, salt-inducible kinase 2, Salt-inducible protein kinase 2, salt-inducible serine/threonine kinase 2, serine/threonine-protein kinase SIK2, Serine/threonine-protein kinase SNF1-like kinase 2, SNF1-like kinase 2 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VHPQLSPRQSLETQYLQHRLQKPSLLSKAQNTCQLYCKEPPRSLEQQLQEHRLQQKRLFLQKQSQLQAYFNQMQI |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?