missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SNF1LK2/SIK2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17676-100UL
This item is not returnable.
View return policy
Description
SNF1LK2/SIK2 Polyclonal antibody specifically detects SNF1LK2/SIK2 in Human samples. It is validated for Immunofluorescence
Specifications
| SNF1LK2/SIK2 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| DKFZp434K1115, EC 2.7.11, EC 2.7.11.1, KIAA0781SIK-2, LOH11CR1I, QIKSNF1LK2, Qin-induced kinase, salt-inducible kinase 2, Salt-inducible protein kinase 2, salt-inducible serine/threonine kinase 2, serine/threonine-protein kinase SIK2, Serine/threonine-protein kinase SNF1-like kinase 2, SNF1-like kinase 2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: VHPQLSPRQSLETQYLQHRLQKPSLLSKAQNTCQLYCKEPPRSLEQQLQEHRLQQKRLFLQKQSQLQAYFNQMQI | |
| 100 μg | |
| Protein Kinase | |
| 23235 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction