missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SNAPC3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | SNAPC3 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18232691
|
Novus Biologicals
NBP2-58320 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18643588
|
Novus Biologicals
NBP2-58320-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SNAPC3 Polyclonal specifically detects SNAPC3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| SNAPC3 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 6619 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FPYLYCHQGDCEHVIVITDIRLVHHDDCLDRTLYPLLIKKHWLWTRKCFVCKMYTARWVTNNDSFAPEDPCFFCDVCFRMLHYDSEGNKLGEFLAYPYVDPGTFN | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| MGC132011, MGC33124, Proximal sequence element-binding transcription factor subunit beta, PSE-binding factor subunit beta, PTF subunit beta, PTFbeta, small nuclear RNA activating complex, polypeptide 3, 50kD, small nuclear RNA activating complex, polypeptide 3, 50kDa, Small nuclear RNA-activating complex polypeptide 3, SNAP50SNAPc 50 kDa subunit, SNAPc subunit 3, snRNA-activating protein complex 50 kDa subunit, snRNA-activating protein complex subunit 3 | |
| SNAPC3 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title