missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SNAPC3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-57713-25ul
This item is not returnable.
View return policy
Description
SNAPC3 Polyclonal specifically detects SNAPC3 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Specifications
| SNAPC3 | |
| Polyclonal | |
| Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| MGC132011, MGC33124, Proximal sequence element-binding transcription factor subunit beta, PSE-binding factor subunit beta, PTF subunit beta, PTFbeta, small nuclear RNA activating complex, polypeptide 3, 50kD, small nuclear RNA activating complex, polypeptide 3, 50kDa, Small nuclear RNA-activating complex polypeptide 3, SNAP50SNAPc 50 kDa subunit, SNAPc subunit 3, snRNA-activating protein complex 50 kDa subunit, snRNA-activating protein complex subunit 3 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 6619 | |
| Human | |
| IgG |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
| SNAPC3 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LPELNTRAFHVGAFGELWRGRLRGAGDLSLREPPASALPGSQAADSDREDAAVARDLDCSLEAAAELRAVCGLDKLKCLEDGEDPEVIPENTDLVT | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction