SNAP43 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-68849

Product Code. 18644379

Description

SNAP43 Polyclonal antibody specifically detects SNAP43 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: SNAP43
• Classification: Polyclonal
• Dilution: Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
• Gene Alias: Proximal sequence element-binding transcription factor subunit gamma, PSE-binding factor subunit gamma, PTF subunit gamma, PTFgamma, small nuclear RNA activating complex, polypeptide 1, 43kD, small nuclear RNA activating complex, polypeptide 1, 43kDa, Small nuclear RNA-activating complex polypeptide 1, SNAP43SNAPc 43 kDa subunit, SNAPc subunit 1, snRNA-activating protein complex 43 kDa subunit, snRNA-activating protein complex subunit 1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: FRKLRLDRAFHFTAMPKLLSYRMKKKIHRAEVTEEFKDPSDRVMKLITSDVLEEMLNVHDHYQNMKHVISVDKSKP
• Quantity: 100 μg
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 6617
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified