missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SMYD2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-09280-100UL
This item is not returnable.
View return policy
Description
SMYD2 Polyclonal specifically detects SMYD2 in Human samples. It is validated for Western Blot, Chromatin Immunoprecipitation.
Specifications
| SMYD2 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation | |
| EC 2.1.1.43, Histone methyltransferase SMYD2, HSKM-Bzinc finger, MYND domain containing 14, KMT3CEC 2.1.1.-, Lysine N-methyltransferase 3C, MGC119305, SET and MYND domain containing 2, SET and MYND domain-containing protein 2, ZMYND14 | |
| The immunogen is a synthetic peptide directed towards the middle region of human SMYD2 (NP_064582). Peptide sequence SMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIES | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| ChIP Assay | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 56950 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction