missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SMURF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

SMURF1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18346564
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18346564 100 μg 100µL
18349421 25 μg 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18346564 Supplier Novus Biologicals Supplier No. NBP317934100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

SMURF1 Polyclonal antibody specifically detects SMURF1 in Human samples. It is validated for Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen SMURF1
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias E3 ubiquitin ligase SMURF1, EC 6.3.2, EC 6.3.2.-, hSMURF1, KIAA1625E3 ubiquitin-protein ligase SMURF1, SMAD specific E3 ubiquitin protein ligase 1, SMAD ubiquitination regulatory factor 1, Smad-specific E3 ubiquitin ligase 1, SMAD-specific E3 ubiquitin-protein ligase 1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: RGLLENEGTVYEDSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHG
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Stem Cell Signaling Pathway
Primary or Secondary Primary
Gene ID (Entrez) 57154
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.