missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SMUG1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

SMUG1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18300833
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18300833 25 μg 25µL
18395515 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18300833 Supplier Bio-Techne Supplier No. NBP31793325UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

SMUG1 Polyclonal antibody specifically detects SMUG1 in Human samples. It is validated for Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen SMUG1
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias EC 3.2.2, EC 3.2.2.-, FDG, HMUDG, MGC104370, single-strand selective monofunctional uracil DNA glycosylase, single-strand-selective monofunctional uracil-DNA glycosylase 1, UNG3
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the amino acids: FLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQT
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Base Excision Repair, Cancer, DNA Repair
Primary or Secondary Primary
Gene ID (Entrez) 23583
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Välj ett problem

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.