missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18430260

SMR3B Antibody, Novus Biologicals™

Product Code. 18430260 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18430260 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18430260 Supplier Novus Biologicals Supplier No. H00010879B01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Polyclonal Antibody

SMR3B Polyclonal antibody specifically detects SMR3B in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen SMR3B
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500
Formulation PBS (pH 7.4)
Gene Accession No. AAH15327
Gene Alias P-B, PBIIMGC104379, PRL3submaxillary gland androgen regulated protein 3 homolog B (mouse), PROL3, proline rich 3, Proline-rich peptide P-B, Proline-rich protein 3, salivary proline-rich protein, SMR1B, submaxillary gland androgen regulated protein 3 homolog B, submaxillary gland androgen regulated protein 3B, submaxillary gland androgen-regulated protein 3B
Host Species Mouse
Immunogen SMR3B (AAH15327, 1 a.a. - 79 a.a.) full-length human protein. MKSLTWILGLWALAACFTPGESQRGPRGPYPPGPLAPPQPFGPGFVPPPPPPPYGPGRIPPPPPAPYGPGIFPPPPPQP
Purification Method IgG purified
Quantity 0.05 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10879
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.