SMOX Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Product Code	Brand	Quantity
18418211	Novus Biologicals NBP2-13356-25ul	25ul
18087428	Novus Biologicals NBP2-13356	0.1 mL

Description

SMOX Polyclonal specifically detects SMOX in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SMOX
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 54498
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: QGFTDVTVLEASSHIGGRVQSVKLGHATFELGATWIHGSHGNPIYHLAEANGLLEETTDGERSVGRISLYSKNGVACYLTNHGRRIPKDVVEEFSDLYN
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: C20orf16, chromosome 20 open reading frame 16, EC 1.5.3.16, flavin containing amine oxidase, flavin-containing spermine oxidase, FLJ20746, MGC1010, PAO, PAO-1, PAOh1, Polyamine oxidase 1, putative cyclin G1 interacting protein, SMOdJ779E11.1, spermine oxidase
• Gene Symbols: SMOX
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only