SMG5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-56778

Product Code. 18284954

Description

SMG5 Polyclonal specifically detects SMG5 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SMG5
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EST1BFLJ12287, EST1-like protein B, Est1p-like protein B, ever shorter telomeres 1B, hSMG-5, KIAA1089FLJ34864, LPTS interacting protein, LPTS-interacting protein, LPTSRP1, LPTS-RP1EST1 telomerase component homolog B, protein SMG5, RP11-54H19.7, SMG-5, SMG-5 homolog, Smg-5 homolog, nonsense mediated mRNA decay factor (C. elegans)
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Human: 100%; Equine: 92%; Mouse: 92%; Pig: 92%; Rat: 85%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9UPR3
• Gene Symbols: SMG5
• Immunogen: Synthetic peptides corresponding to SMG5(Smg-5 homolog, nonsense mediated mRNA decay factor (C. elegans)) The peptide sequence was selected from the N terminal of SMG5. Peptide sequence MSQGPPTGESSEPEAKVLHTKRLYRAVVEAVHRLDLILCNKTAYQEVFKP.
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 23381
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.