SMCX Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-35594-20ul

Product Code. 30229258

Description

SMCX Polyclonal antibody specifically detects SMCX in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot

Specifications

• Antigen: SMCX
• Classification: Polyclonal
• Dilution: Western Blot 1:1000 - 1:5000, ELISA
• Gene Alias: DXS1272EMRXJ, EC 1.14.11, EC 1.14.11.-, Histone demethylase JARID1C, JARID1Clysine-specific demethylase 5C, jumonji, AT rich interactive domain 1C, Jumonji, AT rich interactive domain 1C (RBP2-like), Jumonji/ARID domain-containing protein 1C, lysine (K)-specific demethylase 5C, MRXSJ, Protein SmcX, Protein Xe169, Smcx homolog, X chromosome, SMCXselected cDNA on X, Smcy homolog, X-linked, Smcy homolog, X-linked (mouse), XE169JmjC domain-containing protein SMCX
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1400 to the C-terminus of human SMCX (XP_011529128.1).,, Sequence:, ERHGSRARGRALERRRRRKVDRGGEGDDPAREELEPKRVRSSGPEAEEVQEEEELEEETGGEGPPAPIPTTGSPSTQENQNGLEPAEGTTSGPSAPFSTLTPRLHLPCPQQPPQQQL
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 8242
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG