missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SMCO1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-32354
This item is not returnable.
View return policy
Description
SMCO1 Polyclonal specifically detects SMCO1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| SMCO1 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| C3orf43, Chromosome 3 Open Reading Frame 43, Single-Pass Membrane And Coiled-Coil Domain-Containing Protein 1, Single-Pass Membrane Protein With Coiled-Coil Domains 1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 255798 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| SMCO1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MNNETTTLISLKEAMKRVDHKLQALETQFKELDFTKDNLMQKFEHHSKALASQ | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction