missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SMC2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | SMC2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SMC2 Polyclonal specifically detects SMC2 in Human samples. It is validated for Western Blot.Specifications
| SMC2 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, Core ESC Like Genes, DNA Repair, Stem Cell Markers | |
| 10592 | |
| Synthetic peptides corresponding to SMC2(structural maintenance of chromosomes 2) The peptide sequence was selected from the N terminal of SMC2. Peptide sequence ISNLSQVRASNLQDLVYKNGQAGITKASVSITFDNSDKKQSPLGFEVHDE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| CAP-E, CAPESMC2 structural maintenance of chromosomes 2-like 1 (yeast), Chromosome-associated protein E, FLJ10093, hCAP-EXCAP-E homolog, SMC protein 2, SMC-2, SMC2 (structural maintenance of chromosomes 2, yeast)-like 1, SMC2 structural maintenance of chromosomes 2-like 1, SMC2L1, structural maintenance of chromosomes (SMC) family member, structural maintenance of chromosomes 2, structural maintenance of chromosomes protein 2 | |
| SMC2 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title