missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SMARCA1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | SMARCA1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18236674
|
Novus Biologicals
NBP2-56279 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18695756
|
Novus Biologicals
NBP2-56279-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SMARCA1 Polyclonal specifically detects SMARCA1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| SMARCA1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| ATP-dependent helicase SMARCA1, DKFZp686D1623, EC 3.6.1, EC 3.6.4.-, FLJ41547, global transcription activator homologous sequence, Nucleosome-remodeling factor subunit SNF2L, NURF140, probable global transcription activator SNF2L1, SNF2L, SNF2L1ISWI, SNF2LB, SNF2-like 1, SNF2LT, subfamily a, member 1, sucrose nonfermenting 2-like protein 1, SWI, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a1, SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 1, SWI2 | |
| SMARCA1 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 6594 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KGEKKKEKNVSSFQLKLAAKAPKSEKEMDPEYEEKMKADRAKRFEFLLKQ | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title