SMAGP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-81686

Product Code. 18296626

Description

SMAGP Polyclonal specifically detects SMAGP in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SMAGP
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500
• Gene Alias: hSMAGP, MGC149453, MGC149454, small cell adhesion glycoprotein, small cell transmembrane and glycosylated protein, small trans-membrane and glycosylated protein, Small transmembrane and glycosylated protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 57228
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SMAGP
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:YKNKGSYVTYEPTEGEPSAIVQMESDLAKGSEKEEYFI
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only