missing translation for 'onlineSavingsMsg'
Learn More

Smad5 Antibody (3A10), Novus Biologicals™

Product Code. 18329747 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18329747 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18329747 Supplier Novus Biologicals Supplier No. H00004090M03

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

Smad5 Monoclonal antibody specifically detects Smad5 in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen Smad5
Applications Western Blot, ELISA, Immunocytochemistry
Classification Monoclonal
Clone 3A10
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Immunocytochemistry/ Immunofluorescence
Formulation In 1x PBS, pH 7.4
Gene Accession No. AAH09682
Gene Alias hSmad5, JV5-1DKFZp781O1323, MAD homolog 5, MAD, mothers against decapentaplegic homolog 5 (Drosophila), MADH5mothers against decapentaplegic homolog 5, mothers against decapentaplegic homolog 5, mothers against decapentaplegic, drosophila, homolog of, 5, Mothers against DPP homolog 5, SMA- and MAD-related protein 5, SMAD 5, SMAD family member 5DKFZp781C1895, SMAD, mothers against DPP homolog 5, SMAD, mothers against DPP homolog 5 (Drosophila), Smad5
Host Species Mouse
Immunogen SMAD5 (AAH09682, 105 a.a. ~ 182 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KPLDICEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQPNN
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 4090
Target Species Human
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.