SMAD3, Rabbit anti-Human, Polyclonal Antibody, Abnova™

Rabbit Polyclonal Antibody

Brand:  Abnova H00004088-D01P.100ug

Product Code. 16167521

Description

Sequence: ELRLHHSFVLTGDVGRRICRLLVGLFTKGDTSSKRVHPFSPGPCFLLCDLARVGSSPKINVSPFYQNQTSTQRSCTVFVWQRCSLVGPFQVTVFTMYFHHSLRSISRFSSG

Specifications

• Antigen: SMAD3
• Classification: Polyclonal
• Formulation: In 1x PBS, pH 7.4
• Gene Accession No.: BC000414
• Gene Symbols: SMAD3
• Immunogen: SMAD3 (-, 31 a.a. ∼ 141 a.a) full-length human protein.
• Regulatory Status: RUO
• Gene ID (Entrez): 4088
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Gene: SMAD family member 3
• Gene Alias: DKFZp586N0721/DKFZp686J10186/HSPC193/HsT17436/JV15-2/MADH3/MGC60396
• Host Species: Rabbit
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody