missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLURP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Brand: Novus Biologicals NBP2-13351
This item is not returnable.
View return policy
Description
SLURP1 Polyclonal specifically detects SLURP1 in Human, Chinese Hamster samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| SLURP1 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| ANUPARS(component B)-81/S, ARS component B, ArsB, ARSlymphocyte antigen 6-like secreted, LY6LS, MDMsecreted Ly-6/uPAR-related protein 1, neoplastic urinary protein, secreted LY6/PLAUR domain containing 1, secreted Ly6/uPAR related protein 1, SLURP-1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| SLURP1 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: KEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCN | |
| 0.1 mL | |
| Cytokine Research | |
| 57152 | |
| Human, Chinese Hamster | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction