missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
Slug Monoclonal antibody specifically detects Slug in Human, Mouse, Rat samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | Slug |
| Applications | Western Blot, ELISA, Immunocytochemistry |
| Classification | Monoclonal |
| Clone | 3C12 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_003059 |
| Gene Alias | MGC10182, Neural crest transcription factor Slug, Protein snail homolog 2, slug homolog, zinc finger protein (chicken), SLUGH, SLUGzinc finger protein, snail 2, snail homolog 2 (Drosophila), WS2D, zinc finger protein SNAI2 |
| Host Species | Mouse |
| Immunogen | SNAI2 (NP_003059, 97 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYV |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?