missing translation for 'onlineSavingsMsg'
Learn More

Slug Antibody (3C12), Novus Biologicals™

Product Code. 18361859 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18361859 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18361859 Supplier Novus Biologicals Supplier No. H00006591M05

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

Slug Monoclonal antibody specifically detects Slug in Human, Mouse, Rat samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen Slug
Applications Western Blot, ELISA, Immunocytochemistry
Classification Monoclonal
Clone 3C12
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_003059
Gene Alias MGC10182, Neural crest transcription factor Slug, Protein snail homolog 2, slug homolog, zinc finger protein (chicken), SLUGH, SLUGzinc finger protein, snail 2, snail homolog 2 (Drosophila), WS2D, zinc finger protein SNAI2
Host Species Mouse
Immunogen SNAI2 (NP_003059, 97 a.a. ~ 169 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYV
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Neuronal Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 6591
Target Species Human, Mouse, Rat
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG3 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.