missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLITRK6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | SLITRK6 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SLITRK6 Polyclonal specifically detects SLITRK6 in Human samples. It is validated for Western Blot.Specifications
| SLITRK6 | |
| Polyclonal | |
| Rabbit | |
| Q9H5Y7 | |
| 84189 | |
| Synthetic peptides corresponding to SLITRK6(SLIT and NTRK-like family, member 6) The peptide sequence was selected from the N terminal of SLITRK6. Peptide sequence NFITVIEPSAFSKLNRLKVLILNDNAIESLPPNIFRFVPLTHLDLRGNQL. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ22774, MGC119595, MGC119596, MGC119597,4832410J21Rik, SLIT and NTRK-like family, member 6, SLIT and NTRK-like protein 6, slit and trk like gene 6 | |
| SLITRK6 | |
| IgG | |
| 95 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title