missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLCO6A1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | SLCO6A1 |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18682616
|
Novus Biologicals
NBP2-49118-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18635956
|
Novus Biologicals
NBP2-49118 |
0.1 mL |
£513.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SLCO6A1 Polyclonal antibody specifically detects SLCO6A1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| SLCO6A1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Endocrinology, Signal Transduction | |
| PBS (pH 7.2), 40% Glycerol | |
| 133482 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Cancer/testis antigen 48, CT48Organic anion-transporting polypeptide I, Gonad-specific transporter, GSTOATP-I, MGC26949, OATP6A1Solute carrier family 21 member 19, OATPY, Organic anion-transporting polypeptide 6A1, SLC21A19, solute carrier organic anion transporter family member 6A1, solute carrier organic anion transporter family, member 6A1, testis-specific organic anion transporter | |
| This antibody was developed against a recombinant protein corresponding to amino acids: AGCTYSKAQNQKKMYYNCSCIKEGLITADAEGDFIDARPGKCDAKCYKLPL | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title