SLCO3A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-59678

Product Code. 18255271

Description

SLCO3A1 Polyclonal specifically detects SLCO3A1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SLCO3A1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ40478, OATP3A1OATP-RP3, OATP-DOATPRP3, OATPDSLC21A11, Organic anion transporter polypeptide-related protein 3, Organic anion-transporting polypeptide D, PGE1 transporter, Sodium-independent organic anion transporter D, solute carrier family 21 (organic anion transporter), member 11, Solute carrier family 21 member 11, solute carrier organic anion transporter family member 3A1, solute carrier organic anion transporter family, member 3A1
• Host Species: Rabbit
• Molecular Weight of Antigen: 76 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9UIG8
• Gene Symbols: SLCO3A1
• Immunogen: Synthetic peptides corresponding to SLCO3A1(solute carrier organic anion transporter family, member 3A1) The peptide sequence was selected from the middle region of SLCO3A1 (NP_037404). Peptide sequence MEIAVVAGFAAFLGKYLEQQFNLTTSSANQLLGMTAIPCACLGIFLGGLL The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 28232
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

For Research Use Only