SLC9A7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-62455

Product Code. 18258714

Description

SLC9A7 Polyclonal specifically detects SLC9A7 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SLC9A7
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: SLC9A7
• Immunogen: Synthetic peptides corresponding to SLC9A7(solute carrier family 9 (sodium/hydrogen exchanger), member 7) The peptide sequence was selected from the N terminal of SLC9A7. Peptide sequence LGWGLRVAAAASASSSGAAAEDSSAMEELATEKEAEESHRQDSVSLLTFI.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84679
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: Na(+)/H(+) exchanger 7, NHE-7, NHE7SLC9A6, nonselective sodium potassium/proton exchanger, sodium/hydrogen exchanger 7, solute carrier family 9 (sodium/hydrogen exchanger), solute carrier family 9 (sodium/hydrogen exchanger), isoform 7, solute carrier family 9 (sodium/hydrogen exchanger), member 7, Solute carrier family 9 member 7
• Host Species: Rabbit
• Molecular Weight of Antigen: 80 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Goat: 85%.
• Target Species: Human, Mouse, Canine, Guinea Pig, Goat, Rabbit, Zebrafish
• Isotype: IgG

For Research Use Only