SLC7A9 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Novus Biologicals NBP2-93638-0.1ml

Codice prodotto. 18685800

Descrizione

SLC7A9 Polyclonal antibody specifically detects SLC7A9 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence

Specifica

• Antigen: SLC7A9
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:1000, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
• Gene Alias: b(0+)AT, B(0+)-type amino acid transporter 1, BAT1, bo+ amino acid transporter, CSNU3, FLJ94301, Glycoprotein-associated amino acid transporter b0+AT1, solute carrier family 7 (cationic amino acid transporter, y+ system), member 9, Solute carrier family 7 member 9
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SLC7A9 (NP_055085.1). MGDTGLRKRREDEKSIQSQEPKTTSLQKELGLISGISIIVGTIIGSGIFVSPKSVLSNTEAVGPCLIIWAACGVLATLGALCFAELGTMITKSGGEYPYL
• Quantity: 0.1 mL
• Research Discipline: Amino Acids Drugs and other small molecules, Cancer, Endocrinology, Signal Transduction
• Gene ID (Entrez): 11136
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified