missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC7A8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49319
This item is not returnable.
View return policy
Description
SLC7A8 Polyclonal antibody specifically detects SLC7A8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| SLC7A8 | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| hLAT2, integral membrane protein E16H, large neutral amino acids transporter small subunit 2, LAT2L-type amino acid transporter 2, LPI-PC1, solute carrier family 7 (amino acid transporter, L-type), member 8, Solute carrier family 7 member 8, y+ system), member 8 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: WQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEEANED | |
| 0.1 mL | |
| Amino Acids Drugs and other smAll species molecules, Cancer, Endocrinology, Neuroscience, Signal Transduction | |
| 23428 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction