missing translation for 'onlineSavingsMsg'
Learn More

SLC7A8 Antibody (3F10), Novus Biologicals™

Product Code. 18372279 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18372279 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18372279 Supplier Novus Biologicals Supplier No. H00023428M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

SLC7A8 Monoclonal antibody specifically detects SLC7A8 in Human, Mouse samples. It is validated for Western Blot, ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen SLC7A8
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 3F10
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_036376
Gene Alias hLAT2, integral membrane protein E16H, large neutral amino acids transporter small subunit 2, LAT2L-type amino acid transporter 2, LPI-PC1, solute carrier family 7 (amino acid transporter, L-type), member 8, Solute carrier family 7 member 8, y+ system), member 8
Host Species Mouse
Immunogen SLC7A8 (NP_036376.2, 467 a.a. ~ 535 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VYWQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEEANEDMEEQQQPMYQPTPTKDKDVAGQPQP
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Amino Acids Drugs and other small molecules, Cancer, Endocrinology, Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 23428
Target Species Human, Mouse
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.