missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SLC7A5/LAT1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

SLC7A5/LAT1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Product Code. 18329535 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18329535 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18329535 Supplier Novus Biologicals Supplier No. NBP309988100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

SLC7A5/LAT1 Polyclonal specifically detects SLC7A5/LAT1 in Mouse samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen SLC7A5/LAT1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias 4F2 LC, CD98, CD98LC, D16S469EL-type amino acid transporter 1, E16, Integral membrane protein E16, large neutral amino acids transporter 1, large neutral amino acids transporter small subunit 1, LAT1hLAT1, MPE16CD98 light chain, sodium-independent neutral amino acid transporter LAT1,4F2LC, solute carrier family 7 (cationic amino acid transporter, y+ system), member 5,4F2 light chain, Solute carrier family 7 member 5, y+ system cationic amino acid transporter
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of mouse SLC7A5/LAT1 (NP_003477.4). Peptide sequence IAVSFWKTPVECGIGFTIILSGLPVYFFGVWWKNKPKWLLQGIFSTTVLC
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 8140
Target Species Mouse
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.