SLC6A4/5-HTTLPR/Serotonin transporter Rabbit anti-Human, Rat, Clone: 5T7M2, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand:  Novus Biologicals NBP3-15668-20UL

Product Code. 18327395

Description

SLC6A4/5-HTTLPR/Serotonin transporter Monoclonal antibody specifically detects SLC6A4/5-HTTLPR/Serotonin transporter in Human, Rat samples. It is validated for Western Blot, Immunofluorescence

Specifications

• Antigen: SLC6A4/5-HTTLPR/Serotonin transporter
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Rat
• Form: Purified

• Applications: Western Blot, Immunofluorescence
• Clone: 5T7M2
• Dilution: Western Blot 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
• Gene Alias: 5HT transporter, 5-HTT, hSERT, HTT5-hydroxytryptamine transporter, Na+/Cl- dependent serotonin transporter, OCD1, SERT, sodium-dependent serotonin transporter, solute carrier family 6 (neurotransmitter transporter, serotonin), member 4,5-HTTLPR, Solute carrier family 6 member 4,5HTT
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC6A4/5-HTTLPR/Serotonin transporter (P31645). METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLG
• Quantity: 20 μg
• Research Discipline: Neuroscience
• Gene ID (Entrez): 6532
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG