missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SLC6A4/5-HTTLPR/Serotonin transporter Antibody, Novus Biologicals™

SLC6A4/5-HTTLPR/Serotonin transporter Antibody, Novus Biologicals™

Product Code. 18604317 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
25 μL
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18604317 25 μL 25µL
18276214 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18604317 Supplier Novus Biologicals Supplier No. NBP25772925ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

SLC6A4/5-HTTLPR/Serotonin transporter Polyclonal specifically detects SLC6A4/5-HTTLPR/Serotonin transporter in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Specifications

Antigen SLC6A4/5-HTTLPR/Serotonin transporter
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Formulation PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
Gene Alias 5HT transporter, 5-HTT, hSERT, HTT5-hydroxytryptamine transporter, Na+/Cl- dependent serotonin transporter, OCD1, SERT, sodium-dependent serotonin transporter, solute carrier family 6 (neurotransmitter transporter, serotonin), member 4,5-HTTLPR, Solute carrier family 6 member 4,5HTT
Gene Symbols SLC6A4
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGI
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 6532
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.