SLC6A4/5-HTTLPR/Serotonin transporter Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-57729-25ul

Product Code. 18604317

Description

SLC6A4/5-HTTLPR/Serotonin transporter Polyclonal specifically detects SLC6A4/5-HTTLPR/Serotonin transporter in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: SLC6A4/5-HTTLPR/Serotonin transporter
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: 5HT transporter, 5-HTT, hSERT, HTT5-hydroxytryptamine transporter, Na+/Cl- dependent serotonin transporter, OCD1, SERT, sodium-dependent serotonin transporter, solute carrier family 6 (neurotransmitter transporter, serotonin), member 4,5-HTTLPR, Solute carrier family 6 member 4,5HTT
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SLC6A4
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGI
• Quantity: 25 μL
• Research Discipline: Neuroscience
• Gene ID (Entrez): 6532
• Target Species: Human
• Isotype: IgG

For Research Use Only