SLC6A4/5-HTTLPR/Serotonin transporter Antibody (2A9), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00006532-M06

Product Code. 18397169

Description

SLC6A4/5-HTTLPR/Serotonin transporter Monoclonal antibody specifically detects SLC6A4/5-HTTLPR/Serotonin transporter in Human, Rat samples. It is validated for ELISA, Immunoprecipitation

Specifications

• Antigen: SLC6A4/5-HTTLPR/Serotonin transporter
• Classification: Monoclonal
• Conjugate: Unconjugated
• Gene Accession No.: NP_001036
• Host Species: Mouse
• Purification Method: IgG purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Rat
• Form: Purified

• Applications: ELISA, Immunoprecipitation
• Clone: 2A9
• Formulation: In 1x PBS, pH 7.4
• Gene Alias: 5HT transporter, 5-HTT, hSERT, HTT5-hydroxytryptamine transporter, Na+/Cl- dependent serotonin transporter, OCD1, SERT, sodium-dependent serotonin transporter, solute carrier family 6 (neurotransmitter transporter, serotonin), member 4,5-HTTLPR, Solute carrier family 6 member 4,5HTT
• Immunogen: SLC6A4 (NP_001036, 181 a.a. ~ 252 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGIS
• Quantity: 0.1 mg
• Research Discipline: Neuroscience
• Gene ID (Entrez): 6532
• Content And Storage: Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
• Isotype: IgG2a κ