SLC6A20, Mouse anti-Human, Clone: 3G6, Abnova™

Mouse Monoclonal Antibody

Brand:  Abnova H00054716-M02.100ug

Product Code. 16137706

Description

Sequence: KATFNYENCLKKVSLLLTNTFDLEDGFLTASNLEQVKGYLASAYPSKYSEMFPQIKNCSLESELDTAVQ

Specifications

• Antigen: SLC6A20
• Classification: Monoclonal
• Conjugate: Unconjugated
• Gene: solute carrier family 6 (proline IMINO transporter), member 20
• Gene Alias: MGC161475/SIT1/XT3/Xtrp3
• Host Species: Mouse
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 3G6
• Formulation: In 1x PBS, pH 7.4
• Gene Accession No.: NM_020208
• Gene Symbols: SLC6A20
• Immunogen: SLC6A20 (NP_064593, 301 a.a. ∼ 369 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Regulatory Status: RUO
• Gene ID (Entrez): 54716
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ

Safety and Handling

Product Identifier

• SLC6A20 monoclonal antibody (M02), clone 3G6

Signal Word

• Warning

Hazard Category

• Acute toxicity Category 4
• Serious eye damage/eye irritation Category 2
• Skin corrosion/irritation Category 2

Hazard Statement

• H302-Harmful if swallowed.
• H312-Harmful in contact with skin.
• H319-Causes serious eye irritation.

Precautionary Statement

• P102-Keep out of reach of children.
• P103-Read label before use.
• P233-Keep container tightly closed.
• P264-Wash hands thoroughly after handling.
• P270-Do not eat, drink or smoke when using this product.
• P280-Wear protective gloves/protective clothing/eye protection/face protection.
• P301+P310-IF SWALLOWED: Immediately call a POISON CENTER/doctor /
• P304+P340-IF INHALED: Remove person to fresh air and keep comfortable for breathing.
• P305+P351+P338-IF IN EYES: Rinse cautiously with water for several minutes. Remove contact lenses, if present and easy to do. Continue rinsing.
• P404-Store in a closed container.
• P501b-Dispose of contents/container in accordance with local/regional/national/international regulations.

Supplemental information

• MIXTURE LIST-Contains : sodium phosphate dibasic, potassium phosphate monobasic