missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18327729

SLC6A20 Antibody (3G6), Novus Biologicals™

Product Code. 18327729 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18327729 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18327729 Supplier Novus Biologicals Supplier No. H00054716M02

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

SLC6A20 Monoclonal antibody specifically detects SLC6A20 in Human samples. It is validated for Western Blot, ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen SLC6A20
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 3G6
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_064593
Gene Alias MGC161475, neurotransmitter transporter RB21A, SIT1, sodium- and chloride-dependent transporter XTRP3, Sodium/imino-acid transporter 1, solute carrier family 6 (neurotransmitter transporter), member 20, solute carrier family 6 (proline IMINO transporter), member 20, Solute carrier family 6 member 20, Transporter rB21A homolog, X transporter protein 3, XT3orphan transporter XT3, Xtrp3
Host Species Mouse
Immunogen SLC6A20 (NP_064593, 301 a.a. ~ 369 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KATFNYENCLKKVSLLLTNTFDLEDGFLTASNLEQVKGYLASAYPSKYSEMFPQIKNCSLESELDTAVQ
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 54716
Target Species Human
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.