missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
SLC6A17 Polyclonal antibody specifically detects SLC6A17 in Human samples. It is validated for Immunofluorescence
Specifications
Specifications
| Antigen | SLC6A17 |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | NTT4, orphan sodium- and chloride-dependent neurotransmitter transporter NTT4, Sodium-dependent neurotransmitter transporter NTT4, solute carrier family 6 (neurotransmitter transporter), member 17, Solute carrier family 6 member 17, solute carrier family 6, member 17 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RHFHLLSDGSNTLSVSYKKGRMMKDISNLEENDETRFILSKVPSEAPSPMPTHRSYLGPGSTSPLETSGNPNGRYGSGYLLASTPESEL |
| Purification Method | Affinity purified |
| Vis mere |
Produkttitel
Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.
Ser du en mulighed for forbedring?