missing translation for 'onlineSavingsMsg'
Learn More

SLC6A16 Antibody (2E5), Novus Biologicals™

Product Code. 18357799 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18357799 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18357799 Supplier Novus Biologicals Supplier No. H00028968M13

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

SLC6A16 Monoclonal antibody specifically detects SLC6A16 in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen SLC6A16
Applications Western Blot, ELISA, Immunocytochemistry, Sandwich ELISA
Classification Monoclonal
Clone 2E5
Conjugate Unconjugated
Dilution Western Blot 1:500
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_054756
Gene Alias NTT5solute carrier family 6 (neurotransmitter transporter), member 16, orphan sodium- and chloride-dependent neurotransmitter transporter NTT5, Solute carrier family 6 member 16, solute carrier family 6, member 16
Host Species Mouse
Immunogen SLC6A16 (NP_054756.2, 406 a.a. ~ 492 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RCCERNAEILLKLINLGKLPPDAKPPVNLLYNPTSIYNAWLSGLPQHIKSMVLREVTECNIETQFLKASEGPKFAFLSFVEAMSFLP
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 28968
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.