missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC4A8 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93900-0.1ml
This item is not returnable.
View return policy
Description
SLC4A8 Polyclonal antibody specifically detects SLC4A8 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
| SLC4A8 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| DKFZp761B2318, Electroneutral Na(+)-driven Cl-HCO3 exchanger, FLJ46462, KIAA0739, k-NBC3, Na+-driven Cl-HCO3 exchanger, NBC, NBC3electroneutral sodium bicarbonate exchanger 1, NDCBE, NDCBE1, Solute carrier family 4 member 8, solute carrier family 4, sodium bicarbonate cotransporter, member 8 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human SLC4A8 (NP_001035049.1). MPAAGSNEPDGVLSYQRPDEEAVVDQGGTSTILNIHYEKEELEGHRTLYVGVRMPLGRQSHRHHRTHGQKHRRRGRGKGASQGEEGLEAL | |
| 0.1 mL | |
| Cancer, Endocrinology, Signal Transduction | |
| 9498 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction