missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC4A4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-17023-100UL
This item is not returnable.
View return policy
Description
SLC4A4 Polyclonal antibody specifically detects SLC4A4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| SLC4A4 | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| electrogenic sodium bicarbonate cotransporter 1, hhNMC, HNBC1, KNBC, kNBC1, Na(+)/HCO3(-) cotransporter, NBC, NBC1DKFZp781H1314, NBC2, NBCE1, pNBC, SLC4A5, Sodium bicarbonate cotransporter, sodium bicarbonate cotransporter 1 (sodium bicarbonate cotransporter, kidney;sodium bicarbonate cotransporter, pancreas), Solute carrier family 4 member 4, solute carrier family 4, sodium bicarbonate cotransporter, member 4, solute carrier family 4, sodium bicarbonate cotransporter, member 4, brain type, solute carrier family 4, sodium bicarbonate cotransporter, member 5 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: DIGKTVSSASRMFTNPDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNKF | |
| 100 μg | |
| Endocrinology, Neuroscience, Signal Transduction | |
| 8671 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction