missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC44A2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-10576-100UL
This item is not returnable.
View return policy
Description
SLC44A2 Polyclonal specifically detects SLC44A2 in Human samples. It is validated for Western Blot, Immunohistochemistry.
Specifications
| SLC44A2 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml, Immunohistochemistry | |
| CTL2choline transporter-like protein 2, DKFZp666A071, FLJ44586, PP1292, Solute carrier family 44 member 2, solute carrier family 44, member 2 | |
| The immunogen is a synthetic peptide directed towards the middle region of Human SLC44A2 (NP_065161). Peptide sequence IMVWVMIIMVILVLGYGIFHCYMEYSRLRGEAGSDVSLVDLGFQTDFRVY | |
| 100 μg | |
| Signal Transduction | |
| 57153 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction