SLC41A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-59693

Product Code. 18288322

Description

SLC41A1 Polyclonal specifically detects SLC41A1 in Human samples. It is validated for Western Blot, Immunoprecipitation.

Specifications

• Antigen: SLC41A1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: MgtE, solute carrier family 41 member 1, solute carrier family 41, member 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 55 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunoprecipitation
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunoprecipitation
• Gene Accession No.: Q8IVJ1
• Gene Symbols: SLC41A1
• Immunogen: Synthetic peptides corresponding to SLC41A1(solute carrier family 41, member 1) The peptide sequence was selected from the N terminal of SLC41A1. Peptide sequence TSEFLGPDGAGVEVVIESRANAKGVREEDALLENGSQSNESDDVSTDRGP.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 254428
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

For Research Use Only