SLC3A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-68912

Product Code. 18648416

Description

SLC3A1 Polyclonal antibody specifically detects SLC3A1 in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: SLC3A1
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
• Gene Alias: activator of cystine, dibasic and neutral amino acid transport), member 1, amino acid transporter 1, ATR1SLC3A1 variant C, B(0+)-type amino acid transport protein, CSNU1, D2h, D2HSLC3A1 variant D, dibasic and neutral amino acid transporters), FLJ34681, member 1, NBATneutral and basic amino acid transport protein rBAT, RBATSLC3A1 variant B, SLC3A1 variant E, SLC3A1 variant F, SLC3A1 variant G, solute carrier family 3 (cystine, dibasic and neutral amino acid transporters
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SPKCLDWWQEGPMYQIYPRSFKDSNKDGNGDLKGIQDKLDYITALNIKTVWITSFYKSSLKDFRYGVEDFREVDPIFGTMEDFEN
• Quantity: 100 μg
• Research Discipline: Amino Acids Drugs and other small molecules, Cancer, Endocrinology, Signal Transduction
• Gene ID (Entrez): 6519
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified