SLC39A9/ZIP9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-57957

Product Code. 18217083

Description

SLC39A9/ZIP9 Polyclonal specifically detects SLC39A9/ZIP9 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: SLC39A9/ZIP9
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: FLJ11274, MGC74989, solute carrier family 39 (zinc transporter), member 9, Solute carrier family 39 member 9, zinc transporter SLC39A9, zinc transporter ZIP9, ZIP9, ZIP-9, Zrt- and Irt-like protein 9
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55334
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: SLC39A9
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VPEGVHALYEDILEGKHHQASETHNVIASDKAAEKSVVHEHEHSHDHTQLHAYI
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only