SLC39A5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-69296

Product Code. 18236082

Description

SLC39A5 Polyclonal specifically detects SLC39A5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SLC39A5
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: LZT-Hs7, MGC34778, solute carrier family 39 (metal ion transporter), member 5, Solute carrier family 39 member 5, zinc transporter ZIP5, ZIP5, ZIP-5, Zrt- and Irt-like protein 5
• Host Species: Rabbit
• Molecular Weight of Antigen: 56 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Horse: 86%; Bovine: 86%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q6ZMH5
• Gene Symbols: SLC39A5
• Immunogen: Synthetic peptides corresponding to SLC39A5(solute carrier family 39 (metal ion transporter), member 5) The peptide sequence was selected from the N terminal of SLC39A5. Peptide sequence MGSPVSHLLAGFCVWVVLGWVGGSVPNLGPAEQEQNHYLAQLFGLYGENG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 283375
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only