missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC39A2/ZIP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£385.00 - £587.00
Specifications
| Antigen | SLC39A2/ZIP2 |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18373455
|
Novus Biologicals
NBP3-17439-25UL |
25 μg |
£385.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18357632
|
Bio-Techne
NBP3-17439-100UL |
100 μg |
£587.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SLC39A2/ZIP2 Polyclonal antibody specifically detects SLC39A2/ZIP2 in Human samples. It is validated for ImmunofluorescenceSpecifications
| SLC39A2/ZIP2 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cancer, Cell Cycle and Replication | |
| PBS, pH 7.2, 40% glycerol | |
| 29986 | |
| IgG | |
| Affinity purified |
| Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Eti-1, MGC119190, solute carrier family 39 (zinc transporter), member 2, Solute carrier family 39 member 2, zinc transporter ZIP2, ZIP-2, ZIP2hZIP2, Zrt- and Irt-like protein 2,6A1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: MTAEALEEIESQIQKFMVQNRSASERNSSGDADSAHMEYPY | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title