missing translation for 'onlineSavingsMsg'
Learn More

SLC39A2/ZIP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. p-7248893
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18373455 25 μg 25µL
18357632 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18373455 Supplier Novus Biologicals Supplier No. NBP31743925UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

SLC39A2/ZIP2 Polyclonal antibody specifically detects SLC39A2/ZIP2 in Human samples. It is validated for Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen SLC39A2/ZIP2
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias Eti-1, MGC119190, solute carrier family 39 (zinc transporter), member 2, Solute carrier family 39 member 2, zinc transporter ZIP2, ZIP-2, ZIP2hZIP2, Zrt- and Irt-like protein 2,6A1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: MTAEALEEIESQIQKFMVQNRSASERNSSGDADSAHMEYPY
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Cancer, Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 29986
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.