SLC39A2/ZIP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Bio-Techne NBP3-17439-100UL

Product Code. 18357632

Description

SLC39A2/ZIP2 Polyclonal antibody specifically detects SLC39A2/ZIP2 in Human samples. It is validated for Immunofluorescence

Specifications

• Antigen: SLC39A2/ZIP2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
• Gene Alias: Eti-1, MGC119190, solute carrier family 39 (zinc transporter), member 2, Solute carrier family 39 member 2, zinc transporter ZIP2, ZIP-2, ZIP2hZIP2, Zrt- and Irt-like protein 2,6A1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MTAEALEEIESQIQKFMVQNRSASERNSSGDADSAHMEYPY
• Quantity: 100 μg
• Research Discipline: Cancer, Cell Cycle and Replication
• Gene ID (Entrez): 29986
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified