SLC39A14 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17091-100UL

Product Code. 18336962

Description

SLC39A14 Polyclonal antibody specifically detects SLC39A14 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: SLC39A14
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: Irt-like protein 14, LIV-1 subfamily of ZIP zinc transporter 4, LZT-Hs4, solute carrier family 39 (metal ion transporter), member 14, solute carrier family 39 (zinc transporter), member 14, solute carrier family 39 member 14, zinc transporter ZIP14, ZIP14, ZIP-14, zrt- and Irt-like protein 14
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: STCFSSGDLFTAHNFSEQSRIGSSELQEFCPTILQQLDSRACTSENQENEENEQTEEGRPSAVEVW
• Quantity: 100 μg
• Research Discipline: Cancer, Endocrinology, Signal Transduction
• Gene ID (Entrez): 23516
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified