SLC39A14 Antibody, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand:  Novus Biologicals NBP3-33524-20ul

Product Code. 30231063

Description

SLC39A14 Monoclonal antibody specifically detects SLC39A14 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/Immunofluorescence

Specifications

• Antigen: SLC39A14
• Classification: Monoclonal
• Dilution: Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: Irt-like protein 14, LIV-1 subfamily of ZIP zinc transporter 4, LZT-Hs4, solute carrier family 39 (metal ion transporter), member 14, solute carrier family 39 (zinc transporter), member 14, solute carrier family 39 member 14, zinc transporter ZIP14, ZIP14, ZIP-14, zrt- and Irt-like protein 14
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 31-157 of human SLC39A14 (NP_001121903.1).,, Sequence:, SSLGAPAISAASFLQDLIHRYGEGDSLTLQQLKALLNHLDVGVGRGNVTQHVQGHRNLSTCFSSGDLFTAHNFSEQSRIGSSELQEFCPTILQQLDSRACTSENQENEENEQTEEGRPSAVEVWGYG
• Quantity: 20 μL
• Research Discipline: Cancer, Endocrinology, Signal Transduction
• Gene ID (Entrez): 23516
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified