missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SLC39A13 Rabbit anti-Human, Polyclonal, Novus Biologicals™

SLC39A13 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18396004 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18396004 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18396004 Supplier Novus Biologicals Supplier No. NBP310021100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

SLC39A13 Polyclonal specifically detects SLC39A13 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen SLC39A13
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias FLJ25785, LIV-1 subfamily of ZIP zinc transporter 9, LZT-Hs9, solute carrier family 39 (metal ion transporter), member 13, solute carrier family 39 (zinc transporter), member 13, Solute carrier family 39 member 13, zinc transporter ZIP13, ZIP13, ZIP-13, Zrt- and Irt-like protein 13
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SLC39A13 (NP_001121697.1). Peptide sequence GGEGQSLQQQQQLGLWVIAGILTFLALEKMFLDSKEEGTSQAPNKDPTAA
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 91252
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.