missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC38A8 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£161.00 - £360.00
Specifications
| Antigen | SLC38A8 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18356486
|
Novus Biologicals
NBP3-09889-25UL |
25 μg |
N/A
|
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18067953
|
Novus Biologicals
NBP3-09889-100UL |
100 μg |
N/A
|
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SLC38A8 Polyclonal specifically detects SLC38A8 in Human samples. It is validated for Western Blot.Specifications
| SLC38A8 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| 146167 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Human SLC38A8 (NP_001073911). Peptide sequence VSVLSLLACCLIYSLTGVYGFLTFGTEVSADVLMSYPGNDMVIIVARVLF | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title