missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC38A3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £470.00
Specifications
| Antigen | SLC38A3 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18297073
|
Novus Biologicals
NBP2-58073 |
100 μL |
£470.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18688748
|
Novus Biologicals
NBP2-58073-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
SLC38A3 Polyclonal specifically detects SLC38A3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| SLC38A3 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 10991 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KFHVPCPLPPNFNNTTGNFSHVEIVKEKVQLQVEPEASAFCTPSYFTLNSQT | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| G17sodium-coupled neutral amino acid transporter 3, Na(+)-coupled neutral amino acid transporter 3, NAT1, N-system amino acid transporter 1, SN1system N1 Na+ and H+-coupled glutamine transporter, SNAT3, Solute carrier family 38 member 3, solute carrier family 38, member 3, System N amino acid transporter 1 | |
| SLC38A3 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title