missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
SLC38A10 Polyclonal specifically detects SLC38A10 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
Specifications
| Antigen | SLC38A10 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | FLJ35718, FLJ46399, MGC15523, PP1744, putative sodium-coupled neutral amino acid transporter 10, solute carrier family 38, member 10 |
| Gene Symbols | SLC38A10 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:MKPKQVSRDLGLAADLPGGAEGAAAQPQAVLRQPELRVISDGEQGGQQGHRLDHGGHLEMRKA |
| Show More |
For Research Use Only
Product Title
En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.
Vous avez repéré une opportunité d'amélioration ?